SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6J473 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6J473
Domain Number 1 Region: 112-164
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.0000923
Family Crystallins/Ca-binding development proteins 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K6J473
Sequence length 198
Comment (tr|A0A0K6J473|A0A0K6J473_BACCE) Uncharacterized protein {ECO:0000313|EMBL:CUB10442.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=BN2127_JRS1_02228 OC=Bacillus cereus group.
Sequence
MLKKLVAGTLVAGFALTGGLGVASAEEKSNTIKSFDYLKVDEQNVNSLTKLSDQDKKNIQ
ITMVLPEQNENGDWLAYGFTSRETLDAYIEKDKKVLKNKINPLGSGAGSTDFYEHKNKGG
QYIYWSSGFKNLPSSWNDRISSVSTASPSASYSTTLWEHTSTQGYGKGVVFKHADWYGKT
ANLAADWNDITSAIDVKK
Download sequence
Identical sequences A0A0K6J473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]