SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K8LBC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8LBC1
Domain Number 1 Region: 327-526
Classification Level Classification E-value
Superfamily MIR domain 1.13e-58
Family MIR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K8LBC1
Sequence length 935
Comment (tr|A0A0K8LBC1|A0A0K8LBC1_9EURO) Dolichyl-phosphate-mannose--protein mannosyltransferase 1 {ECO:0000313|EMBL:GAO85635.1} KW=Complete proteome; Reference proteome OX=91492 OS=Aspergillus udagawae. GN=AUD_4595 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPLPRKGRSKSRSPRPKDRKKAPASISSYGSDGVKDNNILHLPTSDYKALVLVTLVALVV
RLFRIYQPSSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKLLITLAGWLAGFDGNFDFKD
IGKDYLEPGVPYVAMRLLPAILGVLTVPLMFLTLKASGCQTITAVLGAGVIIFENGLITQ
SRLILLDSPLVFFTALTALAFTCFANQQELGPSHAFRGSWWFWLAATGLSLGATLSVKWV
GLFTVAWVGSLTVLQLWVLLGDAQNVTPRLWFKHFFARVFCLIIIPLGFYCGMFAIHFLC
LVNPGDGDGFMSSEFQATLNSKGMQDVPADVVFGSRVSFRHLNTQGGYLHSHAHMYPTGS
KQQQITLYPHKDENNVFILENQTQPLGPYGQVEGPYAWDNITTEYIQDGAVVRLYHAVTH
RRLHSHDERPPVTDVDWQFEVSAYGYEGFPGDANDLFRVEIVKSKSDGEEAKKRLRTIES
KFRLVHVMTGCVLFSHKVKLPEWGFDQQEVTCARGGTLPNSLWYIESNNHPMLPEDAEKV
NYRNPGFFGKFWELQKVMWTTNAGLTESHAWDSRPPSWPTLLRGINFWGRDHRQIYLLGN
PFIWWSSTAAIVIYLVFKGIAVIRWQRSCGDYCNVNFKRFDYEVGTSVLGWAFHYFPFYL
MARQLFLHHYFPALYFALMALCQEFDFIANRFKALGLSSRPIIGKGLVAIFLALSIFTFT
LYSPLIYGNPWTQDACKKVKLLSTWDFDCNTFYTDLGQYVTQFVNANPIASSTPSAQVTP
VPGLPVQDSPIQEPPVVPPQQHQQEVHKEAQEASVTPQAKQPRGTMARVEYRDQNGNVLD
EALVASLAKEGKVSFETRHETRTRLEHGHEVEMVDGQIAPPHPDVEGQNPETVKNQEQQA
AGDSPASVAVGESSVEEPSSPEPKPASEANEATQN
Download sequence
Identical sequences A0A0K8LBC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]