SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K8SDS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8SDS7
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 1.05e-37
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1088-1217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-21
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 665-802
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000154
Family SPRY domain 0.07
Further Details:      
 
Domain Number 4 Region: 99-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000109
Family MIR domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8SDS7
Sequence length 2005
Comment (tr|A0A0K8SDS7|A0A0K8SDS7_LYGHE) Uncharacterized protein {ECO:0000313|EMBL:JAG51441.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN= OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MGDTEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
TCVFVIEQALSVRALQELVTAAGTEEGKGGTGSGHRTLLYGNAILLRHQNSDMYLACLST
SSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTK
ENDQSIVNASFHVTHWSVQPYGTGISKMKYVGYVFGGDVLRFFHGGDECLTIPSTWSQDA
SQNVVVYEGGSVLSQARSLWRLELARTKWSGGFINWYHPMRIRHLTTGRYLGVNEANELH
LVPREEATTALSTFILRVEKDDQKVVMEDKDLEVIGAPIIKYGDTTVLVQHCESGLWVTY
KSFETKKKGVGKVEEKQAVLHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFHKFIKGL
EELQLNRRHSLFCATVNLNEMVMCLEDLINYFAQPEEDTEHEEKQNRLRALRNRQDLFQE
EGILNLILEAIDKINVITSQGFLVNLAGDESGHSWDIISGFLYQLLAAIIKGNHTNCAQF
ANTNRLNWLFSRLGSQASGEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASVRPNIFVGRVEGS
AVYQKWYFEVTLDHMEQTTHMTPHLRIGWANTAGYVPYPGGGEKWGGNGVGDDLYSFSFD
GSALWTGGRKTVVLLNNNAPNGPFIRKGDVIGCALDLTVPAIRFTFNGAPISGCFTNFNL
EGMFFPCISCSSKLSCRFLLGGDHGRLKYAPPEEFSPLVESLQPQQVLSIDPCFYFGQLS
KTILSGPFPIESDTAFVPVPVDTTSVSLPNLVETIRDRLAENIHEMWAMNKIEAGWIFGE
LRDDIRRVHPCLVQFEKLPAAEKRYDTQLAVQTLKTIIALGYHITVDKPPSRIKNVRLPN
EPFLQPNGYKPAPLDLSAISLTPKMEELVDQLAENTHNLWAKERIQQGWTYGLNEDPDYC
RSPHLVPYCKVDELIKKANRDTASETVRTLLVYGYNLDPPTGEQTEALLAEAGRLRQMSF
RTYRAEKTYAVTSGKWYFEFEILTAGPMRVGWAAADCPPGHQLGADDHSWAFDGYNEEKV
TSGVAESFGRQWTVGDVVGVFLDLLDHTISFSLNGELLMDTLGGETTFGDVQGEAGFVPA
FTLGVGQKARLVYGQDVNALKFFTTCGLQEGYEPFCVNMNRQVTYWYTKDQPIFENTDDY
ADTRIDVTRIPPGSDTPPCLKVSHNLFETMEKANWEFLRLSLPVICESTFIDENEKIRRW
KEIRMRQQRLMNEAEQQYTTNAQMEQIMRSGFSMSDIKGLTSYPEDAVESDEVMGRSLPA
RNAKGQPPAPPRPPRKGSLSRPDDVIMNGTMESGIGAMNRSTSELDFNRYNGELSDSDKS
QKKRGRSPFRFFSRKNRDTSGSAERPKKGRTPEPQMLEPQVTPTLQRGGLRATKGPGDMK
PPSPLAERTNKGGGMSMSVPAASGIETVGNEMYDAECLKLINEYYYAVRIFPGQDPTHVY
VGWVTTQFHQHAAHFNQNCVLKSTVTVEDSYNRVFDRIERQNCYVVRADELYNEVTQDAS
GKSASQGMIIGCSIDTATGYITFTCEGKDTKHKYRMEPETKLFPAIFVEATSKEILQIEL
GRTSTTLPLSAAVLRNSEKHVIPQFPPRFKVQCLIPHQWARVPNVSLHVHALKLSDIRGW
SMLCEDPVSMIALHIPEEDRCIDVLELIEMEKLLSFHAHTLGLYAALCFQSNYRAAHALC
HHVDQKQLQYAIRAEYMSGPLRRGFYDLLIALHIESHANTMEICKNEFIIPLGPELKELY
EDPDMGNSLKSLQAVSVVPNMKMSDIVIESTENIQTLYSPYFPLDAVRDYVMVALHEAVE
ISQVHNRDPIGGSNENFFLPLLKLTDRLLLVGMLRDEDVMKLLIMFDPETWDPTFEKEGK
DEHRKGLLQMKMAEGAKLQMCYILQ
Download sequence
Identical sequences A0A0K8SDS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]