SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8SL27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8SL27
Domain Number 1 Region: 41-134
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-26
Family Kringle modules 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8SL27
Sequence length 209
Comment (tr|A0A0K8SL27|A0A0K8SL27_LYGHE) Uncharacterized protein {ECO:0000313|EMBL:JAG54022.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN= OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
RHRLIGRNIDLPVCADLPPGNSPHNEDCLSLGVPEPEPVDTADYCYWGNGNDYRGAVGVG
SSGKPCIYWAEQFQLSIADHHELLGNHNFCRNPGSSHAQPWCFVAMKDGRPVAEMCNIHR
CIDTVWLYLTAGVVGLAVLVISLIFYCCCRRSSDKRPSLQHENSLKGSVRSPCRKGKGSG
LEMSALIPGSATSSVKSDARARVREFHPA
Download sequence
Identical sequences A0A0K8SL27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]