SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K8UDX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8UDX0
Domain Number 1 Region: 232-413
Classification Level Classification E-value
Superfamily MIR domain 4.84e-57
Family MIR domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K8UDX0
Sequence length 645
Comment (tr|A0A0K8UDX0|A0A0K8UDX0_BACLA) Protein O-mannosyl-transferase 2 {ECO:0000313|EMBL:JAI24585.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c6_g1_i2 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MCILTLILKMLIGLSGYVTGYNGTYLFEKPGDKYNGSRYEGMRYFCTTLGALIMPMAYDT
VYELTQSTEAAVISSLYLIFDVGLVTLNQYILLDPILLFFLTASVWGMTKASNLTATGNS
YTISWWAWLFFTGTMLACTTSTKFVGLFAVMLVGLHTIQQLWIIFGDMRKPITETVKQIA
CRTIALILWPIILYMYFFYIHLIVLNRSGTGDGFYSSAFQSRLIGNSLYNVSMPRDVTYG
AIVTIKNHKTGGGYLHSHYHLYPKGIGARQQQVTTYTHKDDNNKWLIKPYNKDTIDNIKY
VSHGALIRLEHVATRRNLHSHGEPAPLTKRHLQITGYGEDGQGDANDIWQVLLVDGKQNT
SVKTVTTKFLLIHYLQNCALTTSGQQLPKWGFEQQEVSCNPNLRDKNAFWNVEDNRNEKL
PSVNLNMYAPSFLSTFMESHAVMFQGNAGLKPKEGELTSKPWQWPINYRGQYFSGSSYRI
YLLGNPIIWWSNLAFLILFVFVSSVTIIKQRRLDGRRFVERNCAEVTYSNNGKGEKQQTL
LNAAFWLFIGWITHYVPFWTMGRILYFHHYFPAVIFNSMLAGVMFKYVSSNLPKWMQHTL
FGGMISGLAYSFKLFSPLAYGMSGPLSNEYNSTMYGLRWLSSWEF
Download sequence
Identical sequences A0A0K8UDX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]