SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K8UJP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8UJP4
Domain Number 1 Region: 241-437
Classification Level Classification E-value
Superfamily MIR domain 6.45e-58
Family MIR domain 0.000000179
Further Details:      
 
Domain Number 2 Region: 438-608
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.18e-51
Family IP3 receptor type 1 binding core, domain 2 0.000000797
Further Details:      
 
Domain Number 3 Region: 1211-1367
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.96e-36
Family IP3 receptor type 1 binding core, domain 2 0.0062
Further Details:      
 
Domain Number 4 Region: 111-219
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000000262
Family MIR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8UJP4
Sequence length 2873
Comment (tr|A0A0K8UJP4|A0A0K8UJP4_BACLA) Inositol 1,4,5-trisphosphate receptor {ECO:0000313|EMBL:JAI26575.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c1_g1_i1 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MGDNIIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLNYPPKKFRDCL
IKVCPMNRYSAQKQFWKAAKQSASSNTDTNLLKRLHHAAEIEKKQNDTENKKLLGTAVQY
GSVVQLLHLKSNKYLTMNKRLPSLLEKNAMRVYLDANGNEGSWFYIMPFYKLRSAGDNVV
VGDKVILNPVNAEQQNLHVASNYELPDNPGCKEVNVLNSSTSWKITLFMEHKENQEHILK
GGDVVRLFHAEQEKFLTMDEYKKQQHVFLRTTGRTSATAATSSKALWEVEVVQHDSCRGG
AGHWNSLYRFKHLATGYYLAAELESVGSTTLIHSLDGNGLDTSLKESEKSKCERYRLVPV
PYSTEIASVFELDPTTMARADSLVPQSSYVRLRHLCSNTWVHATSIPIDIDDDKPVMSKV
CCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLDTVTSKLVNGSISINERRSLIALLQ
DIVFFIAGMENEQNKAKALELTIKNPIRDRQKLLREQYILKQLFKILQGPFQEHPSGEAP
FLRLDELSDPKNSPYKNIFRLCYRILRLSQQDYRKNQEYIAKHFGLMQKQIGYDILAEDT
ITALLHNNRKLLEKHITAAEIETFVGLVRKNMLNWDSRFLDYLSDLCVSNRKAIAVTQEL
ICKSVLSSKNSDILIETQIKHFKAPMGDVYRSAAEDSYSLSTLTEVLDDEEKSDLISNST
TTTSWDTTSLNDAPEIEEKYEIHLKWRGQPNSRSMGDLADCAAQGKEEEAAILNYYRHQL
NLFSNMCLNRQYLALNILSPHLDIDLILKCMSDETMPYELRASFCRLMLHLHVDRDPQEP
VTPVKYARLWSEIPSKMSILDYDGKNQQPDQNKEAVRAKFNTTIAFVENYLCNVATKVWL
FTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLCILDCVSETGMDGATPGRFVN
TDIDSEGGVLRSIGDMNTVMTSLALGSVGQAIASPASLALQHRKSVSQMLKEYPLVMDTK
LKIIEILQFILDVRLDYRISCLLSIFKREFDETEISAAAAAAAAAAAAQNAGTAEGTPSD
GNVSSGETSSKNAALMEAAAAAAAALSTRQKNIDLESIGVQAEDIFDCDSGDASNLDLDG
QGGRTFLRVLLHLIMHDYPPLVSGALHLLFRHFSQRQEVLQAFRQVQLLVSDSDVESYKR
IKLDLDILRQSVEKSELWVYKPKTTDEYNTTAERSSDPAIDISNLSNEYRASLSNEQLNE
YKKVKEILIRMNKFCVTSGPNVKPRKHEQRLLRNVGVHTVILDLLQNPYDEKDDVLMKEL
MCLAHEFLQNFCLGNQQNQVLLHNQLDLFLNPGILEAKTVCAIFKDNLALCNEVTDKVVQ
HFVHCIEIHGRHVVYLQFLQTIVKAENQFIRKCQDMVMQELINAGEDVLVFYNDKSSFNQ
FVAMMQSEKSPLSDSSPLRYHVELVKLLACCTMGKNVYTEIKCNNLLSLDDIVTIICNPA
CIPEVKEAYVDFLNHCYIDTEVEVKEIYSSSHMWNLFEKSFLVDINQLIAIGANADKTLL
NYVLSGVTNVLNTFFSSPFSDQSTIVQTRQMIFVQILQATYRLTQCKWLSLADRFNVENC
VRTLAESAKTRNIAIPLDLEQQVVSMSSKTALLTRQTTKWLLASKQPKYETQLSANLMRL
DRSIIEGLQDIVSLLEDQLKPVVEAELSLLVDILYRSELLFPPGTEARKSCESGGFIRKL
IKHTEKLLEEKEEKLCVKVLRTLREMMAIDVNYGDKGDALRNTLLMRYFDRKGGGGSGGI
ISGVGGGGAGGIITGSGIDSRGAGPKTIEAKPDGTDTILIEQQKRIHLVTHGPGAKYLQR
AGKTLHEVQNHLDREGASDLVIELVIKSVHSPSIFVEAVELGIALLEGGNPIIQKGMYQK
FLSGDFNQAFYKVFFEKMKDAQQEIKSTVTVNTSDIAAKAHENKQDVNLELDKIARKHGV
KSNGVVITDELKKELHNAGLATARAYGNARSIHPGDENSAISINSPLEDILAEKLEKHKD
SKDDRNKISNKVLVMQPILRFLQLLCENHNPDLQNLLRNQNNKTNYNLVSETLMFLDCIC
GSTTGGLGLLGLYINENNVALINQTLETLTEYCQGPCHENQNCIATHESNGLDIITALIL
NNINPLGENRMDLVLELKNNASKLLLAIMESRGDSENAERILYNMNPKQLVEVACKAYHQ
EEMIDESDEHDGGDGEADDEVSVSPREVGHNIYILCHQLAQHNKELAALLKACEDPQATS
FDAKMSQALMYYATHTAQIEIVRNDRTLEQIVFPIPEICEYLTTDTKIKILNTAERDDQG
SKVADFFDKAEEMFNEMKWQKKLRGQPFLFWVSSYMSLWSNILFNCVVVINLIVAFFYPF
DNTVPELSSHISLLFWAILLFSLAIVVTLPRESGIRTLIGSVILRSIFLIGPESTLCLLG
VVTVTLKSVHIVSIMGNNGTLEKNFFKIITDMQLLYHCIYIIFCFCGLIFHPFFYSLLLF
DVVYREETLVNVIRSVTRNGRSIVLTAVLALILVYLFSIIGYMFFKDDFLVEVDVDEGQT
SATTPSVPDITVSMAANGAGNTCGAPDAFNKGIFCAGGGNSGADASATATAANGGCGSDA
KERSCDSLVMCIVTTLNQGLRNGGGIGDILRAPSSKESLFAARVIYDLLFFFIVIIIVLN
LIFGVIIDTFADLRSEKQQKELILKNTCFVCGLNRSAFDNKTVSFEEHIKSEHNMWHYLY
FIVLVKVKDPTEFTGPESYVYAMVKAGILDWFPRLRAMSLAAVDADSEQIELRSLQAQLP
EMQLLITSLSQQLHELKDHMTEQRKQKQRLGLLNTAPSNLLACYQLRDANSLS
Download sequence
Identical sequences A0A0K8UJP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]