SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K8V838 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8V838
Domain Number 1 Region: 103-294
Classification Level Classification E-value
Superfamily MIR domain 2.22e-54
Family MIR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K8V838
Sequence length 555
Comment (tr|A0A0K8V838|A0A0K8V838_BACLA) Protein O-mannosyltransferase 1 {ECO:0000313|EMBL:JAI34720.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c2_g3_i5 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MVSQPTFLADFYGINFTMLRFQASSSSFLPYSSHILSLHITDLHIILQTFGRIVLFTIVP
IMLYIGVFFVHLQLLYRAGPHDSIMTSAFQASLDGGLASITKGQPLKVAHGSQVTLRHTH
GRTCWLHSHTHVYPVRYPDKRGSSHQQQVTCYSFKDVNNWWIIKRPHREDLVVGNELDVI
RHGDIIQLVHGITSRGLNSHDVAAPMTPQCQEVSCYIDYEIKMPGELLWRVEILNRETEG
NIWHAIKSEVRLIHHTTGAALRYSGRQLPEWGFNQHEVVADRSVEHKDAIWNVEEHRYTK
TQDQRERERQLLKAEMIPTKKTKLTFLAKFFELQTKMLWGTKQLDTHMYSSSPLEWPLLD
KGIAYWVDTKTGSQIHLLGNIIIWYTGTAALILYILLNIFYVLRRRRLHFDLPEHEWHRF
RQVGDIFLVAYFIHYLPYFTMDRALFLHNYLPAFLFKLLLLCYVFEHIDYLLRLYCYVNC
KYNVKGTLQPQRIWLVRSYRLGILIWLVYVIWVFIKFLPLTYGMQKLSPQKVISLRWKDT
WDFIIQVHKSTSNRI
Download sequence
Identical sequences A0A0K8V838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]