SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K8WKV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8WKV1
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 8.24e-39
Family MIR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 1080-1180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-21
Family SPRY domain 0.028
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000396
Family SPRY domain 0.062
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000157
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 2238-2337
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000968
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K8WKV1
Sequence length 3992
Comment (tr|A0A0K8WKV1|A0A0K8WKV1_BACLA) Ryanodine receptor 44F {ECO:0000313|EMBL:JAI51684.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c2_g2_i5 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTASGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRVKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVVYEGGSVMSQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNENNELVL
VKKEEASIASTTFCLRQEKDDEKKVLEDKDLEVIGVPIIKYGDTTVIVQHCESSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFINALE
TLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINVITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASIRPNIFVGQVDGS
AMYQKWYFEVTMDHIEQTTHMIPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAHLWTGGRRTLVVNDLPHEPYIRKGDVIGVTIDLSIPIITFSFNGSKVRGCFKEFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKYTPPLGFSPLVQCLMPHQNLSLDPCFYFGNLNKN
VLAGPWLIEDDTAFVPNPVDTSGVALPSSVDHIKEKLAENIHEMWALNKIEAGWSWGEHR
DDYQRIHPCLTHFEKLPLPERRYDSQLAVQTLKTIIALGYYITMDKPPARIRPIRLPNEI
FMQANGYKPAPLDLSAVTLSPKLEELVDQLAENTHNLWARERIQQGWTYGLNENSENHRS
PHLVPYSKVDEAIKKANRDTASETVRTLLVYGYILDPPTGEGNEGLLAEAQRLKFAAFRT
YRVEKNYAVTSGKWYFEFEVLTAGPMRVGWARADCHPGTMLGSDDSSWAFDGHNEEKIAG
GTCESFGKQCGHGDIVGVFLDLADHTISFSLNGELLMDALGGETTFAEVSAEGVGFVPAC
TLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMP
DCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMSQFITELEKTRRWE
EIKIRQYQLQREAQDLAIQQQQQAAANVDHMLKGGFTMSDIKGLHQNFHDAVESEEQLAR
SPARPPRRSSLTRNITFESDVTTDMRGSTAFDMVNGINGLNGTDEGIDDKKKRGRSPFKF
FSKKSRDQSRDKTGSTFQETSLERRNTVAHGRNVVNAQLSTKTPTLRLNNADIPISPMQQ
GPKQLTSTTLGQPTIESSGNELFDTECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHL
HSKEFNKSKVRCGSVVIEDEYEVIIDRIDRQSCYVVRADELFNEVTQDSSGKGASQGMFI
GCFVDTSTGIIRFTCEGKETAHRWMMEPDTKLFPAIFVEATSKEILQIELGRTSTTLPLS
AAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDIRGWSMLCEDPVSM
LALHIPEEDRCIDILELIEMDKLLSFHAHTLTLYAALCYQSNYRAAHALCQHVDQKQLLY
AIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGTELKELYSDDEMCHSLR
SLITESVRPQMRMTDITEPIPNIDQLYSPKFPLEVVREFVMEALKEAVEVNQVHNRDPIG
WTNENLFLPLLKLTDRLLLVGVLTDVDVQKLLIMIDPETWDITFEKDGKDEHRKGLLTMK
MAEGAKLQMCYLLHHLYDIQLRHRVESIISFSHDFVGDLQGDQLRRYIEIKQSDLPSAVA
AKKTKEFRCPPREQMNQILCFKNLESDDQENCTCGLDLRSRLYDFHDSLMKKVSLNALQE
PDEVDCNAIEEVKTGPITKIYNFINAVKELEEGPKEIEEPEKKTPEEVFRKVLIKTIVSW
AEESQIENPKLVREMFSLLVRQYDTVGELVRALGKTYVINNRAREDVAEMWVGLSQIRAL
LPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRIHENVMAVMMNTLGRRAQAQSDA
PPQTEGVEGAPPKEKDTSHEMVVGCCRFLCYFCRTGRQNQKAMFDHFDFLLDNANILLAR
PSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYPDLGWD
PVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRAIVEANR
MSERISDRCNMQNEAEGTIAGLNFTHPLPEGDEDEDYIDTGAAILNFYCTLVDLLGRCAP
DASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLTQTPPGEERPKSDMPSGLLPNN
KQSIVLFLERVYGIETQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALSMNRYIGNSI
LPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPAM
LLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSSQGQGSYGASSDEEKRLTMLL
FSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYGRQSGAPDQPQYD
PQPIDTEKVQLNNDLEALVQKFSEHYHDAWASRRLESGWSYGEIRSDNDRKHPRLKPYSM
LSDYERERYRDPVRECLKALVSIGWRIEQSDIDVPLNHRGSTRRQSKPQINDFQSESSPF
NYNPHPVDMTNLTLSREMQNMAERLAENSHDIWAKKKKEELNSCGGVIHPQLVPYDLLTD
KEKRKDRERSQEFLKYMQYQGYKLHKPSKGGVTEGEGGATQAAVELRFSYSLLEKLIQYL
DRATINMKLLKPSTTFSRRSSFKTASRDIKFFSKVVLPLMEKYFSTHRNYFVAMATATNI
TGAASLKEKEMVASIFCKLASLLRNRLSAFGPDVRITVRCLQVLVKGIDAKTLVKNCPEF
IRTSMLTFFNQTADDLGNTILNLQEGKYSHLRGTHLKTSTSLSYVNQVVLPALTAMFDHL
AACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLRTEIERHRPALGSCLGAFS
SCFPVAFLEPHLNKHNQYSLLNRIADHSLEAQDIMVRMESCMPNLETILGEVDFFVESEK
TYNDAPHIIDVILPLLCSYLPFWWAQGPDNVSPTSGNHVTMVTADHMNSLLRNVLKMIKK
NIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMFHKEESMRGFIKS
ATDDTSQVETQLQEDWQLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEDLYNHVAEIF
NIWSKSQYFLKEEQNFISTNEIDNMALIMPTATRRSAITEGAPVTGGKVKKKKKNRDKKR
DKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMQEYDVIEFARNQLTL
PDKLDPSDEMSWQHYLYSKLGKREELADEQALEKPSNQNDKGKDKTQETVDRIVAMAKVL
FGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFARSYYEQWLQ
EENVGQEIMIEDLTQTFEESEKSKKEEEESEGKPDPLTQLVTTFCRGAMTERSGALQEDL
LYMSYAQIAAKSCGEEEEEGGDEEGGGEGNEEGASIHEQEMEKQKLLFHQARLSNRGVAE
MVLLHISASKGVPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMN
SCSVLDLDAFERNTKAEGLGVGSEGAAGEKNM
Download sequence
Identical sequences A0A0K8WKV1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]