SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K8X6W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8X6W4
Domain Number 1 Region: 221-393
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.92e-23
Family Methylesterase CheB, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K8X6W4
Sequence length 395
Comment (tr|A0A0K8X6W4|A0A0K8X6W4_XANVA) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=56459 OS=Xanthomonas vasicola. GN=NX08_00500 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MGTPVALLGRPGQARERLREALGLAGAQVVLEDEPSAVDVQMLRDAEPVAVLVSLEPSIE
DALEALEPAFNMPGVTVIFDEAELTVRREGWEAQRWVRHLAAKLHGHADVLPPGTETEPS
LQPEPGLTLASRQHSDLQLDQHLEAAAHAFESMPSDALFARPSTHDTAPAAAEKPGLSLG
DSSTWGLVDEVTVVVRPRAEADVFALSTGGLSLVDLEHSGSVTGAVLVMAGIGGPDAIRR
LLSALPPEFPRAVLVRMTLDGGKYGNLVRQMGRVSALPVELGEAGQVVAPGKVYVLSDEV
GVHQHAGALAFVAPADPAGLIAALPPADSAVLMLSGANEAMVEASLALAEQGGWLAGQST
DGCYDPAAAARLARQGILTGNPAQLAQALAQRWPA
Download sequence
Identical sequences A0A0E2YVH9 A0A0K8X6W4 A0A2I9SHQ3
WP_010364227.1.10119 WP_010364227.1.13080 WP_010364227.1.15088 WP_010364227.1.21372 WP_010364227.1.22516 WP_010364227.1.24157 WP_010364227.1.25114 WP_010364227.1.46234 WP_010364227.1.47032 WP_010364227.1.51120 WP_010364227.1.51452 WP_010364227.1.60196 WP_010364227.1.63253 WP_010364227.1.64486 WP_010364227.1.76188 WP_010364227.1.79395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]