SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9H3G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9H3G3
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.0000000000523
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.014
Further Details:      
 
Domain Number 2 Region: 91-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000456
Family Prokaryotic DksA/TraR C4-type zinc finger 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9H3G3
Sequence length 255
Comment (tr|A0A0K9H3G3|A0A0K9H3G3_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KMY53420.1} KW=Complete proteome; Reference proteome OX=1679168 OS=Bacillus sp. FJAT-27231. GN=AC623_05015 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLTAEQLSKLRLQLEREKQELEERFATNEHFGFERAHSHESMGELSSYDNHPADEGTELY
ERGKDLALNEHEENQLKNIVRALEAMDRGEYGKCEVCGKEIPLERLEAIPTTAYCIDHSQ
NKIISHDRPVEEGVLMPPFGKFDFDDSADESVAFDAEDSWQEVARWGTSESPSDFIDPPD
HYNDMYIESDENIGYVEDYENFVGVDIEGKNITVYPNEQHEKYEEELDEEDIMTTFGDLP
AFEHDPYVEERERRE
Download sequence
Identical sequences A0A0K9H3G3
WP_049661154.1.42397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]