SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K9M9F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9M9F4
Domain Number 1 Region: 183-370
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.09e-63
Family Methylesterase CheB, C-terminal domain 0.00000684
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily CheY-like 2.7e-28
Family CheY-related 0.0000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9M9F4
Sequence length 371
Comment (tr|A0A0K9M9F4|A0A0K9M9F4_9BACI) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1679167 OS=Bacillus sp. FJAT-27238. GN=AC624_04760 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSKIRVLVTDDSAFMRKVISDILSTDPEIEVIDRAKNGLECIEKCKQLAPDVLTLDIEMP
VMNGLDALEKLMNECPVPIVMLSSLTKEGAEATIHALELGAFDFVTKPSGPISLDIHKVG
DRLIERVKAAAASKVRLKKQMTRVAKPVSSESKAAPVTPATPVIRTKIPSPPAVMRSQVG
GKARLVVLGTSTGGPKALQSVLTAIPANFPAPIAIVQHMPAGFTKSLANRLDSLCQIRVT
EVVDGEYLENGTAYIAPGGFHFEVRQVNGRLQAYLHQEEPRGGHRPSVDILFESVSQLTN
VDKWAIIMTGMGNDGTKGLKLMKELGHVTSIIEDESSCVVYGMPRAAIQAGLADNVAPLE
KIPELLCKLLH
Download sequence
Identical sequences A0A0K9M9F4
WP_016743333.1.1548 WP_016743333.1.4786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]