SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9MBA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9MBA0
Domain Number 1 Region: 39-201
Classification Level Classification E-value
Superfamily YojJ-like 4.97e-49
Family YojJ-like 0.00000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K9MBA0
Sequence length 204
Comment (tr|A0A0K9MBA0|A0A0K9MBA0_9BACI) Cyclic-di-AMP synthase {ECO:0000256|HAMAP-Rule:MF_00838} KW=Complete proteome OX=1679167 OS=Bacillus sp. FJAT-27238. GN=AC624_08020 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLEVNCDTSSLKAELLQELRGISATLDESIHALKNENECVLGTFDQIRTKFSRLETVAAS
FYLQCYLSPYTGKYLDLSKAVQHLAKRRQGALIVVEREDPLDLLLQAGIPIEATMSHSLL
ESIFYPGSPLHDGAVLIRENHIVSAANVLPLSQVVVGEKKLGTRHRAALGLSEKSDAVIV
VVSEETGKASFAMQGHLYPIISPS
Download sequence
Identical sequences A0A0K9MBA0
WP_016740459.1.1548 WP_016740459.1.4786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]