SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K9NTD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9NTD3
Domain Number 1 Region: 30-206
Classification Level Classification E-value
Superfamily MIR domain 7.98e-59
Family MIR domain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9NTD3
Sequence length 220
Comment (tr|A0A0K9NTD3|A0A0K9NTD3_ZOSMR) Stromal cell-derived factor 2-like protein {ECO:0000313|EMBL:KMZ59312.1} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_69G00080 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence
MGLSFLALALFLYISLGIEEGSPIPTSAGSEGVEMTYGSTIKLMHGKTKYRLHSHDVPYG
SGSGQQSVTGFPNVADSNSYWIIRPVPDTSAKQGDVIKHGAIVRIQHMKTRKWLHSHLHA
SPISQNLEVSCFGGDGQSDTGDYWRLEIEGGGKTWKQNQNIRLQHVDTGGYLHSHNKKYT
RIAGGQQEVCGVREKRVDNIWQAAEGVYLPVNEDIRKITS
Download sequence
Identical sequences A0A0K9NTD3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]