SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9NUJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9NUJ4
Domain Number 1 Region: 2-175
Classification Level Classification E-value
Superfamily NAP-like 7.32e-37
Family NAP-like 0.0000809
Further Details:      
 
Domain Number 2 Region: 200-241
Classification Level Classification E-value
Superfamily NAP-like 0.00000405
Family NAP-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K9NUJ4
Sequence length 264
Comment (tr|A0A0K9NUJ4|A0A0K9NUJ4_ZOSMR) Uncharacterized protein {ECO:0000313|EMBL:KMZ59722.1} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_65G00540 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence
MQINDNDKEALKYLKDIKWQNLGDDKRGFKLEFYFDVNPFFSNSILTKTYYVSEDEDEDV
LEKATGTVIDWYPGKNLLEIKEGSDHGKEEEEAEVDAEKEDIEFSHYHSFFKFFSPIDEE
EEEEDEVEDEEDDDSAVSDLQNSIEHDFEIGYIIKENIIPQAVAWYTGEAIESNDVVGDY
DADSDDVDDSVSNYSDLDNWLSGPNDDSAVSDLPNSQEHYFRIAYIIKEKIIPQAVSWYT
EKAREYCDYRDLANIDDIEEYLSS
Download sequence
Identical sequences A0A0K9NUJ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]