SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9PM24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9PM24
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000332
Family Ran-binding domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9PM24
Sequence length 113
Comment (tr|A0A0K9PM24|A0A0K9PM24_ZOSMR) Uncharacterized protein {ECO:0000313|EMBL:KMZ70019.1} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_200G00240 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence
RVKVYRLTDDGKWDDQGTGHVIVDYFKRTKELGLIVIDEKDNETILVHQISSNEIYRRQE
DTIISWRDSNFPTDLALSFQEPVGCSYIWDQIIGIQRDLQFNTIGTSDIYQRT
Download sequence
Identical sequences A0A0K9PM24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]