SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9QPZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9QPZ2
Domain Number 1 Region: 1-38
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.00000000000000249
Family Ribosomal protein L36 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9QPZ2
Sequence length 100
Comment (tr|A0A0K9QPZ2|A0A0K9QPZ2_SPIOL) Ribosomal protein {ECO:0000256|RuleBase:RU000570} KW=Complete proteome; Reference proteome OX=3562 OS=Spinacia oleracea (Spinach). GN=SOVF_161230 OC=Anserineae; Spinacia.
Sequence
MKVRSSVRKMCEFCKVVKRRGRVYVVCSAKPKHKQRQGFTTFAHEGPLINTSGDISSKPL
ISSTPSLRIGLASTVPKVQHPAVMFGWRDAIASLLFKKGD
Download sequence
Identical sequences A0A0K9QPZ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]