SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9YYU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9YYU1
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 5.36e-28
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00028
Further Details:      
 
Domain Number 2 Region: 131-181
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000043
Family AraC type transcriptional activator 0.016
Further Details:      
 
Domain Number 3 Region: 80-127
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000197
Family AraC type transcriptional activator 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K9YYU1
Sequence length 185
Comment (tr|A0A0K9YYU1|A0A0K9YYU1_9BACL) AraC family transcriptional regulator {ECO:0000313|EMBL:KNB73807.1} KW=Complete proteome; Reference proteome OX=54915 OS=Brevibacillus reuszeri. GN=ADS79_07710 OC=Brevibacillus.
Sequence
MNEEYWQAIVECDHAYDGQFWYGVLTTGIFCRPSCKSRVPKKENIRIFANTVEPEKIGLR
PCKRCQPHVQHWRPADEELASRVEQLIDACYQEPLTLQEIASRLFVSPYYLQRSFTKLKL
CSPTQYLSQKRVEAAKELLSETTGSVTDIAMQVGFRTSAYFAQVFHKVTGQTPTQYRTQM
MRELK
Download sequence
Identical sequences A0A0K9YYU1
WP_049737818.1.39251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]