SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0BUZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0BUZ9
Domain Number 1 Region: 217-394
Classification Level Classification E-value
Superfamily MIR domain 2.49e-38
Family MIR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 1055-1182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-22
Family SPRY domain 0.023
Further Details:      
 
Domain Number 3 Region: 667-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000115
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 100-184
Classification Level Classification E-value
Superfamily MIR domain 0.000000327
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4216-4280
Classification Level Classification E-value
Superfamily EF-hand 0.000000342
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 6 Region: 2247-2346
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000915
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0BUZ9
Sequence length 5136
Comment (tr|A0A0L0BUZ9|A0A0L0BUZ9_LUCCU) Ryanodine receptor 44F {ECO:0000313|EMBL:KNC23059.1} KW=Complete proteome; Reference proteome OX=7375 OS=Lucilia cuprina (Green bottle fly) (Australian sheep blowfly). GN=FF38_06409 OC=Oestroidea; Calliphoridae; Luciliinae; Lucilia.
Sequence
GKMAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPD
LSQCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHNNSDMYLACLS
TSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTT
KENEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGRE
AGQNIVVYEGGSVMSQARSLWRLELARTKWTGGFINWFHPMRIRHITTGRYLGVNDNNEL
ILVKKEEAAIATTTFCLRVEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCESGLWLS
YKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFINA
LETLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPPDDMEHEEKQNRFRALRNRQDLFQ
EEGVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIQGNHTNCA
QFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHG
RDPKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASIRPNIFVGRVE
GSAMYQRWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFG
FDGAYLWTGGHKTLVMDNVPEEPFIRKGDVVGVTIDLSVPVITFTFNGLKVKGSFRDFNL
DGMFFPVMSCSSKLSCRFLFGGDHGRLKFNPPPGFSPLVQCLMPHQILSLDPCFYFGNLS
KNVLAGPWMIEDDNAFVPKPVDTSGVSLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGE
HRDDYHRIHPCLTQFEKLPPAEKRYDNQLAVQTLKTIIALGYYITMDKPPARIRPIRLPN
EIFMQANGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENL
RSPHLVPYSKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGNEALLAEALRLKFAAF
RTYRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCNPGAMLGSEDTSWAFDGHNVTKL
HAGTVEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFAEVTAEGVGFVP
ACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEE
MPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMSEFITEAEKARR
WEEIKIRQYRLMRDAQEQQQQQTSAHMDHMLKSGFTMNDIKGLNRNFDDTAEADEMHSPA
RPPRRSSVSRNITFESDLGAPEELQRSTSALDMNGMDESMMDDKKKRGRSPFKFFSKKSR
DQSKEKMPGRAPEVSMERRNTVAHGRNVVNAQTTTKAPTLRLNNTEMPQTPVQQGPKALS
GGALGQPSVESSGNEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLHSKEFN
KDKVRRGSVIIEDDYEMPMERINRQSCYVVRADELFNEVTQDASGKGASQGMFVGCFVDT
ATGMISFTCEGKETSHRWKMEPGTKLFPAIFVEATSKEILQIELGRTATTLPLSAAVLPT
SDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDIRGWSMLCEDPVSMLALHIP
EEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIRSEY
MSGPLRQGFYDLLIALHLESHATTMEVCKMEYIIPLGPELKFLYEDEEMCHSLRSLITES
VQPHLRMTEITTPMSTHTTSIQNVSSEPIPDIDHLYSPKFPLEVVREFVMEALQEAVEIN
QVHNRDPIGWTNENLFLPLLKLTDRLLLVGVMTDDDVQKLLVMIDPETWDPSFEKDGKDE
HRKGLLTMKMAEGAKLQMCYLLHHLYDIQLRHRVESIIAFSHDFVGDLQADQLRRYIEIK
QSDLPSAVAAKKTKEFRCPPREQMNQILCFKNLEPDDHENCTCGLDLRGRLYDFHDSLMK
KVSLNALQEPDEPESNAIEEVKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPEEVFRK
VLIKTIVSWAEESQIETPKLVREMFSLLVRQYDTVGELVRALEKTYVINNKAREDVAEMW
VGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLG
RRAQAQSDAPAQSEGAEGAPAKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLL
DNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVE
KGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGL
FRAIVEANRMSERISDRCKMQDEAEGTIAGLNFSHPLPEGEEDEDYIDTGAAILNFYCTL
VDLLGRCAPDVSVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLTQTAPGEERPKSD
MPSGLLPNNKQSIVLFLERVYGIETQELFYRLLEDAFLPDLRTATILDKSDGSESDMALS
MNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVA
LTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSSQGQGSYGASSD
EEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYGRQS
GAPDQPQYDPNPIDTVSVNLTNDYNSLVQKFSEHYHDAWASRRLESGWTYGEIRSDSDRK
HPRLKPYNMLTEYERERYRDPVRECLKALLALGWTIEHSEIEVPQNHRGSTRRQSKPQIH
DFQNEGSAFNYNPHPVDMTNLTLSREMQNMAERLAENSHDIWAKKKKEELDSCGGVIHAQ
LVPYDLLTDKEKRKDRERSQEFLKYMQYQGYKLHKPSKGGVAEGEGGAATTAVELRFSYS
LLEKLIQYVDRATINMKLLKPSTTFSRRSSFKTASRDIKFFSKVVLPLMEKYFSTHRNYF
IAVATATNNVGAASLKEKEMVASIFCKLASLLRNRLSAFGPDVRITVRCLQVLVKGIDAR
TLVKNCPEFIRTSMLTFFNQTADDLGNTILNLQDGKYSHLRGTHLKTSTSLGYINQVVMP
VLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHERKYLKTEIERHRPA
LGSCLGAFSSCFPVAYLEPHLNKHNQFSLLNRIADHSLEAQDIMVKMESCMPNLETILGE
VDQFVESDNTYNDAPHIIDVILPLLCSYLPFWWSQGPDNVSPTSGNHVTMVTADHMNSLL
RNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMFHKE
ESMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEE
LYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAITEGTPVTGGKVKK
KKKNRDKKRDKDKEIQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMPEYDVI
EFAHLQLTLPDKLDPSDEMSWQHYLYSKLGKKEEVSEEQAVEKASNQNEKGKDKTQETVD
RIVAMAKVLYGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFA
RTYHEQWLQEENVGQEVMIEDLTQTFEEFEKSKKEEDESESKPDPLTQLVTTFCRGAMTE
RSGALQEDVLYMSYAQIAAKSCGEEEEEGGGEEEGGEGGEEAAEGEGTSIHEQEMEKQKL
LFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEK
KDVGFFTSIAGLMNSCSVLDLDAFERNTKAEEYIPSAGAGLGVGSEGAAGEKNMHDAEFT
CALFRFIQLTCEGHNLDWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKE
IIDPAGKANFFKAIGVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQE
KLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESAGNVELILKY
FDMFLKLKDLIESPSFQEIDIKNEGWVTPKDFRDKMEQSKNYTPEEMDFLLACCERNHEG
KIDYAAFVDRFHEPSTEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRI
EILGSSKRIERVYFEIKDSNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDA
IFEMTHASGLMATDDGGSNVKRDTSYSSYMSEEDEERAARHPVTRTINAVKDGLKFAAVM
LSPANIKHQIGVMQTKSAPELIVGFFKIIFYMFYYTGYAHFAVVRYIFGILMNLMRGPAP
EEVEEAPVEEETFGRALPPLPIEEPPGTVQAFGLDINKEENGQYKVTVHESSGGSPSTSV
EETGESSPEDGGPTGEATAETESHVEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASI
EAEAKKSSAAPQETPAVNQIDFSAYAHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKV
TSFTEDEEASGDDVLILGSGSGAGMTGSGLGSGEGSGDDGGEEDDIPELVHVDEDFFYME
HVIRIAAILHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFDGLFIAEQPEDDDFKSH
WDKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSSFMAQEADEGGLVK
YIMNIDWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTI
LQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHL
YKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQL
ESVKENMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQE
TYVWNMYQQRSWDFFPVGDCFRKQYEDELSGGGGGG
Download sequence
Identical sequences A0A0L0BUZ9
KNC23059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]