SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0C5M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0C5M5
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-107
Family Capz alpha-1 subunit 0.0000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0C5M5
Sequence length 286
Comment (tr|A0A0L0C5M5|A0A0L0C5M5_LUCCU) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KNC26729.1} KW=Complete proteome; Reference proteome OX=7375 OS=Lucilia cuprina (Green bottle fly) (Australian sheep blowfly). GN=FF38_11409 OC=Oestroidea; Calliphoridae; Luciliinae; Lucilia.
Sequence
MDQTQISDTEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDALLKEGASHAFAQYNKDQL
TPVRIEGSEHNAVISEFNDLGGGRFYDPRTKQSFKYDHLRKEASDYQDADTDASAEPWRA
ALDIETLAYTASHYRHGVCSVFGKTQSGQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQ
VGAGTAELKGNLKVQVHYYEDGNVQLVSSKECRESVVVTNEQQMAKEIIRLIEEAENEYQ
LAISENYQTMSDTTFKAMRRQLPITRTKIDWTKIVSYSIGKELKTQ
Download sequence
Identical sequences A0A0L0C5M5
KNC26729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]