SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0CKU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CKU0
Domain Number 1 Region: 241-459
Classification Level Classification E-value
Superfamily MIR domain 8.72e-58
Family MIR domain 0.000000176
Further Details:      
 
Domain Number 2 Region: 460-630
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 9.42e-53
Family IP3 receptor type 1 binding core, domain 2 0.000000579
Further Details:      
 
Domain Number 3 Region: 1207-1359
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.45e-36
Family IP3 receptor type 1 binding core, domain 2 0.0075
Further Details:      
 
Domain Number 4 Region: 111-218
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000484
Family MIR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CKU0
Sequence length 2810
Comment (tr|A0A0L0CKU0|A0A0L0CKU0_LUCCU) Inositol 1,4,5-trisphosphate receptor {ECO:0000313|EMBL:KNC32983.1} KW=Complete proteome; Reference proteome OX=7375 OS=Lucilia cuprina (Green bottle fly) (Australian sheep blowfly). GN=FF38_03739 OC=Oestroidea; Calliphoridae; Luciliinae; Lucilia.
Sequence
MGDNIIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLNYPPKKFRDCL
IKVCPMNRYSAQKQFWKAAKQSASSNTDTNLLKRLHHAAEIEKKQNETENKKILGQQIQY
GSVVQLLHLKSNKFLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIMPFYKLRSIGDNVV
VGDKVILNPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKITLFMEHKENQEHILK
GGDVVRLFHAEQEKFLTMDEYKKQQHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRGG
AGHWNSLYRFKHLATGYYLAAELDSENVNTSGQQQQQQQQVQQPLQQQLINLSGENAKDS
GIGCNSTMIEKTKLEQYRLVSVPFSTDIATVFELDPTTMARADSLVPQSSYVRLRHLCSN
TWVHATSIPIDIDDDKPVMSKVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLATV
TAKLDNGTISINERRSLISLLQDIVYFIAGMENEQNKTKALELTIKNPNRDRQKLLREQY
ILKQLFKILQGPFQEHPGCDGPFLRLDELSDPKNSPYKNIFRLCYRILRLSQQDYRKNQE
YIAKHFGLMQKQIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMHNWDSR
FLDYLSDLCVSNRKAIAVTQELICKSVLSTKNSDILIETQVKAIKQKKTNNVNKKEHSPL
TPLAEDEDDEKISLLSTNTTSTWDLDSLDEEEEVKYEIHLKWKGLQESRSMADLANCVAQ
GKELEAAILNYYRHQLNLFSNMCLNRQYLALNNLSPHLDIDLILKCMSDESMPYELRASF
CRLMLHLHVDRDPQEPVTPVKYARLWSEIPSKMSILDYDGKNQPADYNKEAVRAKFNTTI
QFVENYLCNVAAKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLCILDC
VSDNNIESSTASNTGRFVAADTDSEGGVLRSIGDMNTVMTSLALGSVGQVMATPAISLQQ
RKSVSQLMKEFPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDESDAQQQAQAE
AAAAAQNQVNPGDPQAAAQAFQQRQKNIDLESIGIQAEGIFDCDSGDAANLDLDGQGGRT
FLRVLLHLILHDYPPLVSGALHLLFRHFSQRQEVLHAFRQVQLLVSDSDVESYKQIKHDL
DILRQSVEKSELWVYKSKTSEELNTTGGESTIDNVTLSNEYKASLSSEQLNEYKKVKEIL
IRMNQFCVTPGPYVKPRKHEQRLLRNVGVHTVVLDLLQNPYDEKDDVLMKELMFLAHEFL
QNFCLGNQQNQVLLHNHLDLFLNPGILEAKTVCAIFKDNLALCNEVTDKVVQHFVHCIEI
HGRHVVYLQFLQTIVKAENQFIRKCQDMVMQELINAGEEVLVFYNDKSSFNQFVTMMQKQ
KTALSDDSPLKYHVELVKLLACCTMGKNLYTEIKCNNLLSLDDIVAIICNPACIPEVKEA
YVDFLNHCYIDTEVEMKEIYSSGHMWNLFEKSFLVDINLLIAGGINADKSLMNYVLNGVC
TILATFFSSPFSDQSTIVQSRQMIFVQLLQACYRLSQCKWLSLADRFNVENCIRTLAESA
KTRSIAIPLDLEQQVVTMSSKTALLTRQTTKWLLASKQPKYETQNSGNLMRLDRSIIEGL
QDIVSLLEEQLKPVVEAELSLLVDILYRSELLFPVGTDARRRCESGGFIRKLIKHTEKLL
EEKEEKLCVKVLKTLREMMAIDVNYGEKGDNLRNTLLKRYFDIKPCNSSRTPVEQKNDLA
ALVMPSQESQKHLNMVTHGPGAKYLQRAEKTLHEVQNHLDREGASDLVIELVIKSVHSPS
IFVEAIELGIALLEGGNPIIQKGMFNKFLSGDLNQPFFKVFFDKMKDSQQEIKSTVTVNT
SDIAAKAHESKQDVNLELDKISRKHGVKTNGVVITEELRKELHNAGLATARAFSNARNLH
AGEDSNSLNINSPLEDILAEKLDKHKDNKEERNKLSNKVLVMQPILRFLQLLCENHNPDL
QNLLRNQNNKTNYNLVSETLMFLDCICGSTTGGLGLLGLYINENNVALINQTLETLTEYC
QGPCHENQNCIATHESNGLDIITALILNNINPLGENRMDLVLELKNNASKLLLAIMESRG
DSENAERILYNMNPKQLVEVACKAYHQEEMIDDNDSDDDPVDTDHDDEDVSVSPREVGHN
IYILCHQLAQHNKELAALLKASEDPQSANFDAKMSQALMYYATHTAQIEIVRHDRTLEQI
VFPIPEICEYLTTDTKMKIFHTAERDDQGSKVVDFFDKAEEMFNEMKWQKKLRGQPFLFW
VSSYMSLWSNILFNCVVVINLIVAFFYPFDNTVPELSPHISLLFWAILIFSLVIVVTLPR
ESGIRTLIGSIILRSIFLLGPESTLCLLGVVTVTLKSVHIISIMGNKGTLEKHFFKIITD
FQLLYHCIYIVFCFCGLLFHPFFYSLLLFDVVYREETLVNVIRSVTRNGRSIVLTAVLAL
ILVYLFSIIGYMFFRDDFLVPVDVEEVENVVDATLSVTPDGTCPSPDGLQTSRLVETGGG
GDVKERACDSLVMCIVTTLNQGLRNGGGIGDILRAPSSKEGLFAARVIYDLLFFFIVIII
VLNLIFGVIIDTFADLRSEKQQKELILKNTCFICGLNRSAFDNKTVSFEEHIKSEHNMWH
YLYFIVLVKVKDPTEFTGPESYVYAMVKAGILDWFPRLRAMSLAAVDADGEQIELRSMQA
QLLETQMLITNLSQQLHELKDHMTEQRKQKQRLGLLNTTASSFLAGYQFQ
Download sequence
Identical sequences A0A0L0CKU0
KNC32983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]