SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0DBB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0DBB4
Domain Number 1 Region: 9-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-83
Family Capz alpha-1 subunit 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0DBB4
Sequence length 280
Comment (tr|A0A0L0DBB4|A0A0L0DBB4_THETB) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KNC49406.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_05409 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MGDEYDIPDEEKLEIVTGFLLDAPPGEFNEVVTDVRTLLGNDDLLNQKFAATAQAYNTSH
MVAVDLPDADHKVLLTKYGEISPSEYLDPRSAQVVTVDHAKLEVTGTAPAPAPGANEDTR
AAVDAAMVAYVAEFYPNGQVATYATETGLVICISAAKFSPGNFWNGRWRSVWTVTINGED
VTFEGKFNLLVHYYEDGNVQLNSEFTTSTEVTAATPEEIAEAAAAEIAREESSYQSAVGE
SYAVMSERTFKGLRRKLPVTRHLMDWEKTAGYNLAREMGS
Download sequence
Identical sequences A0A0L0DBB4
XP_013757830.1.50528 AMSG_05409T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]