SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0DEE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0DEE3
Domain Number 1 Region: 3-250
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.28e-77
Family Capz beta-1 subunit 0.0000000524
Further Details:      
 
Weak hits

Sequence:  A0A0L0DEE3
Domain Number - Region: 311-371
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0DEE3
Sequence length 574
Comment (tr|A0A0L0DEE3|A0A0L0DEE3_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC49698.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_11924 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MDELDCALDLMRRLPPADVEENLAGVIDLVPDLMDELLSAVDQPLRVEKDEASGKDYLLC
DYNRDGDSYRSPWSNAYNPPLDYDGTFPSERLRTFEEKANGVFDTYRSLYYEGGVSSVYA
WDLDSGFACVVLIKKTEDGSGKKGAKGSWDSIHVVEVQENGADVHYKITSTIMLSLITNV
PGCDDVNLSGSLTRQATSDANVSSQDSSAPHIVNIGKLVEEMESKMRNALEQIYFGKTND
IISSDLRVASGLGEANRRKALATQAMAEMGARSEFVNTLQRLHELYNAQTRTLEQELLQS
QAVVVDQRNLISSLEAKVAGLNARVAEVEASHRAVVSERAHLLDENVQLAAALQKTKTDL
SKLVHFKQAILHTFDDPDLAPSAAFSPQRSGASYATPRAGASAEPPLSSSVSAALNIADR
YSTMAASELAYAGTGVATQSPPANNYAAPSTPLRSSVSNAAADELIAEINRSINSPSSAA
RASPVRPRTMPPSASTAPASPGGPALDSVDGREFFRAARARLSYEQFNAFLESIKALNNH
QVTRDDTLRKAWELFGPAGEDLYAQFKALISKHA
Download sequence
Identical sequences A0A0L0DEE3
AMSG_11924T0 XP_013757604.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]