SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0DL11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L0DL11
Domain Number - Region: 368-400
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0994
Family Capz alpha-1 subunit 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0DL11
Sequence length 493
Comment (tr|A0A0L0DL11|A0A0L0DL11_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC53034.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_09326 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MSSTKSGKKAEKESKSRTKLNKAEMNEKQRVRSQNLRREMKELFTYLGQLLGCDPKEKVK
NIVSLAIRRLEEQALLISELQAAGMVASGGTAQSASPLMRGSSNIVGMHAVPDIRTQQAQ
LSPSQVSQPQVQSQAQSQAQAQAQQQMAMRALAEANLQQAHARAMQAQAQVQAQARLAAQ
AQAAANAAAEQLRAAESARESAGLFPPDLTSSLTPAMADMSIARNSGSNGRSMSSGPQSL
TSSESLIPGPRLASSLQSNSGSIVWGEDGGTAASSAAPSIAIPSGVAGQFGMDALGNSLY
APMNMVGAGMPRSGPSSFMAATTSYFGGPVPTTSVTPAPSLAAPPSTISPQAVAPAGAVS
GTNSNSLSHLGISTEFNDLINSYLDPTSNSFGLNLSDPSLALGDVNDMILASPSEIVPPT
AAQQQAKRKFQLSASQDTNLPIITDTLPPKQARVRPTKRRRRRRETTEGVATSNTMASNA
EELDEYESNTQSG
Download sequence
Identical sequences A0A0L0DL11
AMSG_09326T0 XP_013754712.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]