SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0F4I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0F4I4
Domain Number 1 Region: 148-234
Classification Level Classification E-value
Superfamily BEACH domain 6.93e-38
Family BEACH domain 0.0000388
Further Details:      
 
Domain Number 2 Region: 27-126
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000295
Family PreBEACH PH-like domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0F4I4
Sequence length 244
Comment (tr|A0A0L0F4I4|A0A0L0F4I4_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KNC71544.1} KW=Complete proteome; Reference proteome OX=667725 OS=Sphaeroforma arctica JP610. GN=SARC_15912 OC=Eukaryota; Ichthyosporea; Ichthyophonida; Sphaeroforma.
Sequence
MMAKQLPTMADIASLARAGIVAATTKKITCDIVTPGLTCSGTLKLTSSAFSVTVNMDDLQ
VEGDSKYMAYIDSIGGTWPYNLVEAVYPRRHMLRTTAVEIFLTNQKPLMFVFSNSDDLAT
VIRALPASWLGIGRKGFLGLRSDLRSAPEIFAIADITKRWQQRQMTNFEYLMRINTLSGR
TYNDLNQYPVFPWVLSNYTSEILDLSDPANYRDLSKPVGALNETRLKSFVERCDCGCWCI
PVFT
Download sequence
Identical sequences A0A0L0F4I4
SARC_15912T0 XP_014145446.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]