SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0F7G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0F7G2
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily MIR domain 6.67e-26
Family MIR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0F7G2
Sequence length 98
Comment (tr|A0A0L0F7G2|A0A0L0F7G2_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KNC72677.1} KW=Complete proteome; Reference proteome OX=667725 OS=Sphaeroforma arctica JP610. GN=SARC_14762 OC=Eukaryota; Ichthyosporea; Ichthyophonida; Sphaeroforma.
Sequence
MGSQLTIKANRISGALLHSHVQTYPKEVGPAQQQVTTYSHKDHNNNWMIKPYDESPYLGA
ENVRLLRHGDYIRLEHMSTKRLLHSHKENAPITTKHKQ
Download sequence
Identical sequences A0A0L0F7G2
XP_014146579.1.97753 SARC_14762T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]