SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0FAI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0FAI2
Domain Number 1 Region: 103-163
Classification Level Classification E-value
Superfamily BEACH domain 4.97e-25
Family BEACH domain 0.0003
Further Details:      
 
Domain Number 2 Region: 3-95
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-18
Family PreBEACH PH-like domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0FAI2
Sequence length 163
Comment (tr|A0A0L0FAI2|A0A0L0FAI2_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KNC73531.1} KW=Complete proteome; Reference proteome OX=667725 OS=Sphaeroforma arctica JP610. GN=SARC_13909 OC=Eukaryota; Ichthyosporea; Ichthyophonida; Sphaeroforma.
Sequence
LYEDIVVSVNVEQVSALTTNPGRLVLTNAMLYFQPFNNIHADPVQKYKLGDLVNLVNRRY
LLKEKGLELFFMLSKSLFFSFEAQNDRDRFVVLLSRQPSVTRLEPSNRENMIQKWQDGEI
DNFTYLLYLNSVADRSFNDLTQYPVFPWVLKDYTSKRLDLQNP
Download sequence
Identical sequences A0A0L0FAI2
XP_014147433.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]