SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0FUS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0FUS4
Domain Number 1 Region: 160-202
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000023
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 
Weak hits

Sequence:  A0A0L0FUS4
Domain Number - Region: 11-55
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0432
Family Capz alpha-1 subunit 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0FUS4
Sequence length 224
Comment (tr|A0A0L0FUS4|A0A0L0FUS4_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KNC80316.1} KW=Complete proteome; Reference proteome OX=667725 OS=Sphaeroforma arctica JP610. GN=SARC_07329 OC=Eukaryota; Ichthyosporea; Ichthyophonida; Sphaeroforma.
Sequence
MINPIQEELIDTVYKNHYSKSPSDHYSKSPSDFFNYICITKNTGSHGRFWDGMKRLINFK
ASGTTETTMQTLEEIRQGLLDVGEVIPGKHIICAILYSLGNDYQLLRSNIFDLDTDKLDI
NEVYRMTFKFDGDHHNATSNTTMRINAITTQPDPKDVKDKRQPREITCPLCKEVGHSIYG
CQKFNCRQCGSKDHIGKKCPADRSTLTCSKGDNKPGHNDEACIE
Download sequence
Identical sequences A0A0L0FUS4
XP_014154218.1.97753 SARC_07329T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]