SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0FZ03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0FZ03
Domain Number 1 Region: 425-632
Classification Level Classification E-value
Superfamily MIR domain 4.05e-36
Family MIR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0FZ03
Sequence length 658
Comment (tr|A0A0L0FZ03|A0A0L0FZ03_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KNC81796.1} KW=Complete proteome; Reference proteome OX=667725 OS=Sphaeroforma arctica JP610. GN=SARC_05901 OC=Eukaryota; Ichthyosporea; Ichthyophonida; Sphaeroforma.
Sequence
MFSGDRVRRRMPSEDALNLEESSSFIVEDDDDKYAPKPHGTGLPPLDHGRIRASSEMPQN
LYGEHTYPQQHHMYTNTGMGNSMDMGTLGNMSSRESMSHNSSMYNSNPGPYAPAPGTPFD
MAYSHLTDAKDAIPDYRAKTHKLALVFMSLMALLTRLFRLGAPPNVVWDEVHFGKFASYY
LRRSFFFDVHPPLGKMLYALVGYMAGYDGSYDFAKISTPYKGIEPPVPYFALRLAPALCG
TLQVPITYLTVIELGGSNVAAVVASALLLFDNGHITQSRFILLDGWLITFILMAFYFYCC
FRTQNRLYPFSVKWWVYLCLSGTFLALAASVKLVGVFVIAVVGVHTALELWRVWKDTRNA
IWPTFAAHLGSRVACLIVLPVCIVLCVFQAHFAVLIHSGPGDSHMSRQFQSQLIGSPHAQ
QVEPMPQDIAFGSIITFTPQQFKPDCWIHSHEHRWPKVYFEGTKKRRVGSAQQQVTCYPH
QDHNNQWMVLEPDRYTKYHHNVMNLTMDIDGGEEPHAVTKFVRHGDNIKLYHVSTQTFLH
THDVASYGFPSKQEVSTWNGSETVAPMTDFTIQFTEAGGEAGKRWHPFRTRFRLVHVATQ
TTLEMSGERLPDFAFGQYEIISSKHTTTKDVFYVDTHKNGTGKRTPFAITTTYIIGLG
Download sequence
Identical sequences A0A0L0FZ03
XP_014155698.1.97753 SARC_05901T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]