SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0G330 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0G330
Domain Number 1 Region: 32-57,173-351
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-59
Family G proteins 0.000000351
Further Details:      
 
Domain Number 2 Region: 61-180
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.03e-35
Family Transducin (alpha subunit), insertion domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0G330
Sequence length 352
Comment (tr|A0A0L0G330|A0A0L0G330_9EUKA) Guanine nucleotide-binding protein G(I) subunit alpha-2 {ECO:0000313|EMBL:KNC83246.1} KW=Complete proteome; Reference proteome OX=667725 OS=Sphaeroforma arctica JP610. GN=SARC_04502 OC=Eukaryota; Ichthyosporea; Ichthyophonida; Sphaeroforma.
Sequence
MGCGISSEDKDAFDKNKQLDNQLKAEKDKLRNEVKLLLLGAGESGKSTVVKQMKIIHENG
FSKEECLQFRDVVYDNTIFCMQTILRAFPQLGLEVPEDVKKYEAEMLDLGENLEGVGMRE
PVAHAIKELWACPVVQEAYTRQKEFQLNDSAKYYFDDIDRIAAPEYMPTDQDVLRSRIKT
TGIIETNFVYKNLQFRMFDVGGQRSERKKWIHCFENVTAIIFCVSLSAYDLMLTEDESQN
RMHESLKLFDSICNSKWFERTSIILFLNKTDLLKLKILTSPLAQCFPEYTGGDNYSEASA
YIRSKFEALNRSQEKQVYTQFTCATDTDNVKFVFNAVTDIIIQNNLRDCGLL
Download sequence
Identical sequences A0A0L0G330
XP_014157148.1.97753 SARC_04502T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]