SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0GB79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0GB79
Domain Number 1 Region: 2-25
Classification Level Classification E-value
Superfamily Notch domain 0.00000667
Family Notch domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0GB79
Sequence length 132
Comment (tr|A0A0L0GB79|A0A0L0GB79_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KNC86255.1} KW=Complete proteome; Reference proteome OX=667725 OS=Sphaeroforma arctica JP610. GN=SARC_01577 OC=Eukaryota; Ichthyosporea; Ichthyophonida; Sphaeroforma.
Sequence
MNKYANGVCNTECNKRVCGYDGGDCNSSNKRFKLANKCDLSIDVAVSYMTNDGTWVSRCW
YDVDPLTTTTLVSDSTPLVSANLVWYVYTEVRTGFHVWSGDADRQCNGRTLPFRKVTGAA
TDSTWAYAFTCA
Download sequence
Identical sequences A0A0L0GB79
SARC_01577T0 XP_014160157.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]