SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0H037 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0H037
Domain Number 1 Region: 27-105
Classification Level Classification E-value
Superfamily YdhA-like 2.09e-22
Family YdhA-like 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0H037
Sequence length 107
Comment (tr|A0A0L0H037|A0A0L0H037_9ENTR) Lysozyme inhibitor {ECO:0000313|EMBL:KNC94063.1} KW=Complete proteome OX=379893 OS=Trabulsiella odontotermitis. GN=GM31_16485 OC=Enterobacteriaceae; Trabulsiella.
Sequence
MKKRLIAIIPFMLAGCSYYNQFVERMQTDKLEYQCDEKPLTVKLNNTREEVSFIYDNQPR
TLKQGLSASGARYTDGVYVFWSKGDSATVYKRDRIVLNNCQLQNPQR
Download sequence
Identical sequences A0A0L0H037
WP_049856675.1.73081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]