SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0HJE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0HJE2
Domain Number 1 Region: 174-258
Classification Level Classification E-value
Superfamily MIR domain 0.0000314
Family MIR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0HJE2
Sequence length 275
Comment (tr|A0A0L0HJE2|A0A0L0HJE2_SPIPN) Uncharacterized protein {ECO:0000313|EMBL:KND01232.1} KW=Complete proteome; Reference proteome OX=645134 OS=Spizellomyces punctatus DAOM BR117. GN=SPPG_04323 OC=Spizellomycetales; Spizellomycetaceae; Spizellomyces.
Sequence
MLETAETVEIRLHAADLLEKLPHTVPHRTGNWTEESVLREEKMREFLTNYEKGMANVKKG
ERRAKTARKEQILSPKLVYDANIMLKNGHTQSHLSADIPDSFPDNIAPSTILALTTCATE
TSPTARSCFQLVRLDEDGNTEESVPRFGERFYIVVTSDLVDAPMYLTSEPKSFLNYAKLS
KDQAVYLTFNRDYRSVWQFDYPDPNFRLEMEGQDVAPNTPVLIKHCNTGNYLSSDKKYGL
RTDFGVEWEVACHTYKDYGTRLELDQNHWLLRVSE
Download sequence
Identical sequences A0A0L0HJE2
XP_016609271.1.7107 SPPG_04323T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]