SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0KR00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L0KR00
Domain Number - Region: 77-118
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0403
Family Recombinase DNA-binding domain 0.051
Further Details:      
 
Domain Number - Region: 16-66
Classification Level Classification E-value
Superfamily Barstar-related 0.0471
Family Barstar-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0KR00
Sequence length 122
Comment (tr|A0A0L0KR00|A0A0L0KR00_9ACTN) Transcriptional regulator {ECO:0000313|EMBL:KND40263.1} KW=Complete proteome OX=146820 OS=Streptomyces stelliscabiei. GN=IQ64_35160 OC=Streptomyces.
Sequence
MTRAGDEPFVAAVKPLVDAMGGLMLPPDEAGPDDVVLSWEGADVVAVRLPQLAESLDHIL
AAMERRKGRPLADLDRKAKQEVVRTLEARGAFSVRHGVETVASALGVSRFTVYNYLNREK
EA
Download sequence
Identical sequences A0A0L0KR00 A0A286ECL7 M3FNH4
WP_005482167.1.101488 WP_005482167.1.16795 WP_005482167.1.24432 WP_005482167.1.94594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]