SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0S551 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0S551
Domain Number 1 Region: 112-154
Classification Level Classification E-value
Superfamily SAP domain 0.0000000000513
Family SAP domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0S551
Sequence length 165
Comment (tr|A0A0L0S551|A0A0L0S551_ALLMA) Uncharacterized protein {ECO:0000313|EMBL:KNE57536.1} KW=Complete proteome; Reference proteome OX=578462 OS=Allomyces macrogynus ATCC 38327. GN=AMAG_18065 OC=Blastocladiales; Blastocladiaceae; Allomyces.
Sequence
MAAAIAAVAGKWRAAAFDPSAFQRTDTLQFARVMHAKALDRPVVEPPPDVDESGLTPDYA
RWQARVASAAKAFLAAAGPLSRAGTTKAAVPAVKRKRGPDEMDTEVLAAAHKWLAENGSL
NQWTIQQLKEVLRELGLPLSGRKAELVDRVETALRETQADAGSGA
Download sequence
Identical sequences A0A0L0S551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]