SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0UT30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0UT30
Domain Number 1 Region: 371-558
Classification Level Classification E-value
Superfamily MIR domain 5.1e-56
Family MIR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0UT30
Sequence length 793
Comment (tr|A0A0L0UT30|A0A0L0UT30_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KNE89899.1} KW=Complete proteome; Reference proteome OX=1165861 OS=Puccinia striiformis f. sp. tritici PST-78. GN=PSTG_16647 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MPCKSDRQKVLQGVEMTLITSLWKMKIADRKSQASRTNPTHQLTFDLLITAIIQMKNLLS
KNLQLVQLSISLVNFQLRKSAISLHDNMVKSGLHQSKSKLAMLLSLVQELTSAQYVVPRT
PLPRIATISRTYEVLTHTTEEARMTRKSFFALADALKDHHIFYNNSNNPQAPGEMQLIVA
LSHLGMCGNGGSPHVLAQYYNISPGSVENYTNRCMLAIIKTLERKHVYWPNAQQRATLTE
TLQGKTVFDGCISFVDGTIFPLASAPTKHKEDYWMRCVTSVKWIGLFVTALVGAHTLDEL
WEKFGDLRMPIRTYIQHWIARILCLVILPVLVYMSFFKIHFLILNRSGPGDAQMSSLFQA
NLYGNDFARSPLEIAIGSKVTIKNMGFGGGLLHSHVQSYPTGSQQQQVTCYHYRDANNEW
TVTPLLHEPTYDETQPMKFLKHGSVVRLVHTFTGRNLHTHSIPAPITTLNHEVACYGNAT
VDDSNSYWMIEVVDDTIRGRRKNFENIHILSTRFRIRNLNLGCYLRAANAILPQWGFKQV
EVSCDKQNDPSDQHTYWNVEGHINPRLPEGDMKLMKSPFLRDFWHLNVAMMTANNALIPD
PDKEDVTASTPFEWPFLYTGMRMNAWIDQGIKFYLIGNPLTWWLCSFSLIIYSVSLVWYL
GRYKRQINDLSPVEWRRFIFVGKVALGGWILHYAPFLFMGRVTYMHHYFPALWFSILMFG
LMVDHFIFKAKTSKLISLTKLNKLVICLTLCLSILFTGIWFKDCAWGIIGPVHLYKYRQW
RKSWSIYEDHTTG
Download sequence
Identical sequences A0A0L0UT30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]