SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0VYK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0VYK6
Domain Number 1 Region: 171-202
Classification Level Classification E-value
Superfamily MIR domain 0.000000732
Family MIR domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0VYK6
Sequence length 265
Comment (tr|A0A0L0VYK6|A0A0L0VYK6_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KNF04394.1} KW=Complete proteome; Reference proteome OX=1165861 OS=Puccinia striiformis f. sp. tritici PST-78. GN=PSTG_02311 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MVPDTLEEFKNVALAMQYMEQVQALVTTNGAKVSGSMYAHGFRHATTETSTIELGYTNKI
PKTKPEGAKIEQIGNEKMRVVNKFFKVRALELAHGCIKANNYLAEQMPQALARQTGEKRR
MESNMYWAQTSHGPKINSATSLTLTTIQTPLCMSCQHPFLPRMVLSGCGRTHKVKSPDWG
FGQQEVTCNQNPTLASSLWYIESNYQPLLEKEKKPLMVNYLKPSFWTKFSEVQSVMWQTN
KALVQHHAYGSRPSSWPILKRGMNL
Download sequence
Identical sequences A0A0L0VYK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]