SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L1HKU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1HKU0
Domain Number 1 Region: 1144-1329
Classification Level Classification E-value
Superfamily MIR domain 3.4e-49
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 33-129,184-387,447-480
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-35
Family WD40-repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L1HKU0
Sequence length 1578
Comment (tr|A0A0L1HKU0|A0A0L1HKU0_9PLEO) Glycosyltransferase family 39 protein {ECO:0000313|EMBL:KNG46460.1} KW=Complete proteome; Reference proteome OX=183478 OS=Stemphylium lycopersici. GN=TW65_06686 OC=Pleosporaceae; Stemphylium.
Sequence
MVEAEGSPTTWKFTQCFGDKGDVEDITEASAADIISTVEFDQTGNYLATGDKGGRVVLFE
RNETKKTCEYKFHTEFQSHEPEFDYLKSLEIEEKINKIKWCRRQNASHYLLSTNDKTIKL
WKVFEKSLKVVAENNLSHELTPGGGVAGGGGPVRNPNAQFRSATDLKLPRLTHHDTVVAA
VPRKTYANAHAYHINSISVNSDGETFISSDDLRINLWNLNIQDQSFNIVDIKPANMEELT
EVITAAEFHPISCNWFMYASSKGTIKLADMRESALCDQHAKQFEQEEDPSSRSFFSEIIS
SISDVRFSHDGRYILSRDYLTVKIWDVNMEKTPVKTIPIHEHLRPRLCDTYENDSIFDKF
EVVFSGDAKNVMTGSYNNNFMIYPSDNDKDTEVVLQADKSAFKAKKVGIPTPMNSSTSPT
GSSNSKKGGSRAGSPAAGAAGQGQRMRKETDADQIDFNKKILHMSWHPFEDSIAIAATNN
LFVFSALQEPESGLLITLFQFVFTCLSTLHYQFDPNGRYFMRSSAVPFRKWCVSAALFFT
VNMLNNWAFAFNISVPVHIILRSFGSVTTMAAGWLRGKKYSALQVISVAILTLGVMVSAW
ADASSKGKNMETSSSDKSNSSLQAGLLILLIAQLLSAWMGAYVEDIYKDHGKDWQANLFY
SHLLSIPFFAGFAPTLMQQFKRLQASQSFQVPPKVAASLPPLLNDALASTSQHVIYLTAN
ALTQLLCITGVNMLSANTSAVTVTIVLNIRKLVSFLLSIWIFGNQMSGLMKVGAAMVFGA
GALYGWETSYRIPQQKKSGAEKQKKSSFIQPQPTMSSPAGSVRQRVGKDKKRAVSPNPEA
LTEKVANVVEKAKPYKPAQQQGREWDYKLAITIMTVLAFITRFWGIRHPDQVVFDEFASY
YLQRTYFFDVHPPLGKLLFAFAGWVVGYKGDFLFENIGDSYITNKVPYVAYRAMPASLGA
LTVPIVFMIMWESGYSLPACVTAAGLMLLDNAHIGQTRLILLDASLIFFMALSVLSYIRF
YKERHVPFGRKWWKWLLLTGISLSCVISIKYVGVFTFFSIGVPVLIDLWDLMDVNRRQGA
LTLAEFGKHFAARAVGLVIVPFFLYLFWFQVHFSILTRSGPGDDFMTPEFQETLSDNVMS
LQSVGINYYDSITIRHKETKVYLHSHPDRYPLRYDDGRVSSQGQQVTGYPHNDTNNHWQV
LPSTPLASEVGQRVKVGDTIRLRHLITDTILLTHDVASPYYPTNQEFTTVNKEEAAGARY
NDTLFQLKVDKGKGDFKTMSTHFKLIHVPTKVAMWTHTKPLPDWAYKQAEINGNKAVQQS
SNVWYVDDIPSLPVEDERNKKQPKQVKHLSFLRKWVELQRAMFHHNNALTSSHPYASQPI
SWPFLLRGVSFWTKNDTRQQIYFLGNPIGWWLASSLLAVFAGIIGADQLALRRGMDALDE
RTRSRLYNSTGFFFLTWAAHYIPFYIMGRQLFLHHYLPAHLASCLITGALVEFVFCIEPQ
DPEMPAAAKGHRRTRSRPVRERVATSSLMGSWIATVVILAATFWCFLFFAPLTYGNPGLS
VPQVQARKWLGYDLHFAK
Download sequence
Identical sequences A0A0L1HKU0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]