SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1IGI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1IGI4
Domain Number 1 Region: 4-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-64
Family Capz alpha-1 subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L1IGI4
Sequence length 276
Comment (tr|A0A0L1IGI4|A0A0L1IGI4_PLAFA) F-actin capping protein {ECO:0000313|EMBL:KNG78726.1} KW=Complete proteome; Reference proteome OX=580059 OS=Plasmodium falciparum IGH-CR14. GN=PFMG_04808 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNNMLNEKKNFIRHVLMNSPPGKLYDLVKDINILLGSSVSIQKILEEVLKDYNEKNYNFI
LTDKNEYVITCKKFKVNHLYFIPKLKALVHVNHLKRTANVLETVKELKYPEELENYRKEC
DKKLVDYVQEHYKKWSNLQTINYPEVHIKSPNGLRSEHCSSVYAYNEEDIFYLFFIICCD
RSYLKNFHASTWRSSWTAQFFVDNDHVLLSGTIDISLTYFEDANINFKTSKCFEKKVRVN
RDVDMFSSNILSAINEYENYILYDLNNFFTNISYYT
Download sequence
Identical sequences A0A0L1IGI4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]