SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L1J2A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1J2A7
Domain Number 1 Region: 338-537
Classification Level Classification E-value
Superfamily MIR domain 2.88e-58
Family MIR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L1J2A7
Sequence length 929
Comment (tr|A0A0L1J2A7|A0A0L1J2A7_ASPNO) Protein mannosyltransferase 1 {ECO:0000313|EMBL:KNG85877.1} KW=Complete proteome; Reference proteome OX=1509407 OS=Aspergillus nomius NRRL 13137. GN=ANOM_003654 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPPKSKNALDVQPPTKASRSSSRSPKPKNRKKAAAETLNYGSDGVKDNSIFSLPTSDYKA
LVLVTLVAAAVRLFRIYQPTSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKLLLTLAGWL
AGFNGDFDFKEIGKDYLEANVPYVAMRMLPAIMGVLTVSLMFLTLKASGCRTTTAVLGAG
VVIFENALVTQSRLILLDSPLVFFTALTAMSFTSFTNQQELGPSHAFRGPWWFWLAATGL
CLGATLSVKWVGLFTVAWVGSLTIIQLWVLLGDTKNVTPRLWFKHFFARFFCLIVIPLGF
YCGMFAIHFLCLVNPGEGDGFMSSEFQATLNSKAMQDVPADVVFGSRISLRHLNTQGGYL
HSHNHMYPTGSKQQQITLYPHKDENNIFIAENQTQPLGPDGEIAGPFAWDNITAEYIEDG
AIIRLNHLMTQRRVHSHDERPPVTEADWQYEVSAYGFEGFAGDANDMFRVEIVKSMSEGE
EAKKRLRTIQSKFKLVHVMTGCVLFSHKVKLPDWGWEQQEVTCAKGGTLPNSVWYIESNS
HPMLPADAEKVNYRNPGFLGKFWELQKVMWTTNAGLTESHAWDSRPPSWPTLLRGINFWG
TDHRQIYLLGNPLIWWSSTLAIGIYVLFKGISILRWQRNCADYRNVNFKRFDYEVGTSVL
GWAFHYFPFYLMARQLFLHHYLPALYFAIITLCQEFDFLANRIHALGLASKPAIGKALAG
IFLALSIFTFTLYSPLVYGNPWTQDACRKVKLLDTWDFDCNTFHTDLGQYVTHFTNTNVA
IPTTQAPPPEVPVVPPPQQDQQILQEEAEDASVTPEPQPPVAKARVEYRDQDGNVLDENL
VAALAKEGKVSFETRHETRTRLEHGHEVEMINGQVAPPHPDVEGQNPETIGKQKQAAHDG
PASAAGGSSAAEPNPPEAKPASEGNEATN
Download sequence
Identical sequences A0A0L1J2A7
XP_015406800.1.67048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]