SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6V835 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6V835
Domain Number 1 Region: 112-182
Classification Level Classification E-value
Superfamily BEACH domain 0.0000000235
Family BEACH domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L6V835
Sequence length 228
Comment (tr|A0A0L6V835|A0A0L6V835_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KNZ56864.1} KW=Complete proteome; Reference proteome OX=27349 OS=Puccinia sorghi. GN=VP01_22g3 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MLLPSSRVKWGLQTFFTAIMLKNTLRGAPERERQTFKPITSAGLQIQTFPSSCNQPYRIQ
NPITPEPTFCSLEVIITVFFNSGVLAELEEHQDESLQMNKVLNNAMLISLLNSNNLKEIC
ISAEAHGNPGIFVELHCEALEFDIPIANIHHWIDLSNHALDAINIFQDILYKGTVSFGLF
SHWIQISIELGRDFICIVDEGERRSVLGAMCFPEPAKLPPSISILGSR
Download sequence
Identical sequences A0A0L6V835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]