SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L6VD04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6VD04
Domain Number 1 Region: 140-328
Classification Level Classification E-value
Superfamily MIR domain 1.31e-55
Family MIR domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L6VD04
Sequence length 589
Comment (tr|A0A0L6VD04|A0A0L6VD04_9BASI) Dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:KNZ58666.1} KW=Complete proteome; Reference proteome OX=27349 OS=Puccinia sorghi. GN=VP01_1880g1 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MSLSLPSLDSSCSIQPYSSSPSPRPFDFEWWFWLSMTGLSIGCVTSVKWIGLFVTALVGA
HTADELWEKFGDLRMPLVSHSLNQSISFRPQPFSHLSILIVKQRTYLKHWAARIICLIIL
PVIMSSLFQANLLGNDFARSPLEVAIGSRVTIKNMGFGGGLLHSHGQSYPTGSQQQQVTC
YHYRDGNNEWVVTPLLHEPTYNESQPIKLLKHGSVIRLAHMLTGRNLHTHSIPAPLTTLN
NEVACYGNVTIDDSNSYWMIEVVDDMIRGKRKNFENIHILSTRFRLRNLNLGCYLRAANA
ILPQWGFKQVEVSCDKQNDPSDHHTHWNVEQHVNPRLPEGDMKLMKSPFLKDFWHLNVAM
MTSNNALIPDPDKEDATASTPLEWPFVYTGMRMNAWLDNGIKFYLIGNPLTWWLSSSGLV
LYSLLLLWYLARYKRQINDLSPIEWRRFIFGGKIALGGWILHYAPFFFMGRVTYLHHYFP
ALWFSILMFGVMVDHFVFKAKSNKLVPLTPANKLGICLTLCLAILLTGFWFRDCAWGIAS
PIHLYKYRQWRKVRSYPHTLSFLSVRCSSLTSDPFLVQSWSIYDDHSTK
Download sequence
Identical sequences A0A0L6VD04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]