SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L7KKM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KKM7
Domain Number 1 Region: 203-291
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000392
Family MIR domain 0.0041
Further Details:      
 
Domain Number 2 Region: 159-201
Classification Level Classification E-value
Superfamily MIR domain 0.0000000497
Family MIR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KKM7
Sequence length 314
Comment (tr|A0A0L7KKM7|A0A0L7KKM7_9NEOP) Putative mannosyltransferase 1 {ECO:0000313|EMBL:KOB63903.1} KW=Complete proteome; Reference proteome OX=104452 OS=Operophtera brumata (winter moth). GN=OBRU01_24653 OC=Geometroidea; Geometridae; Larentiinae; Operophtera.
Sequence
MLIGLSGKLTGYDGKFPFEKPVLHCTGRCNNSIDFSHSMLSWQLFLGAALACTVSVKFVG
LFVVLFSLTVEHLVGRSITLIVWPAILYIFFFWIHLTVLNRSAPDRQQPAQCQRAESGRI
RRHHNPEEPQDWWGVPALSSSSVPSGGGRETTAERVDGVVVVRSGDLVRLTHAQTARNVH
SHRERAPLTTKYLQVTGYGETARNVHSHRERAPLTTKYLQVTGYGETARNVHSHRERAPL
TTKYLQVTGYGEDGIGDANDVWKIVISGGKDGDEILTVRSKLMFVHYLQGNAGLKPKEGE
LTSQPWQWPINYRV
Download sequence
Identical sequences A0A0L7KKM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]