SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7LHY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7LHY0
Domain Number 1 Region: 48-127
Classification Level Classification E-value
Superfamily WWE domain 0.000000000392
Family WWE domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7LHY0
Sequence length 206
Comment (tr|A0A0L7LHY0|A0A0L7LHY0_9NEOP) Uncharacterized protein {ECO:0000313|EMBL:KOB75015.1} KW=Complete proteome; Reference proteome OX=104452 OS=Operophtera brumata (winter moth). GN=OBRU01_07958 OC=Geometroidea; Geometridae; Larentiinae; Operophtera.
Sequence
PRLCSVSSKVPPSYSATLWTYLLLSLRKGLWVEGVAILNRRCAMCRAEIPPDYLDHPILL
ERLSPQQLNTDDAQVEYHGGECTLLLAGALYSIDFENMTQVKCNDRTRRRHVRRDTPLFP
AKGIAGIKSENSNRQPTKTDDNSNSNNNQDQADDVIDLVIVDDDSDSDVQIVNSEPVVIQ
IDDISEELDRLSLVNSEVPEPSSGDA
Download sequence
Identical sequences A0A0L7LHY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]