SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7LTN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7LTN7
Domain Number 1 Region: 13-117,157-193
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.000000000392
Family Putative isomerase YbhE 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7LTN7
Sequence length 232
Comment (tr|A0A0L7LTN7|A0A0L7LTN7_9NEOP) Putative Polyadenylation factor subunit {ECO:0000313|EMBL:KOB78848.1} KW=Complete proteome; Reference proteome OX=104452 OS=Operophtera brumata (winter moth). GN=OBRU01_01357 OC=Geometroidea; Geometridae; Larentiinae; Operophtera.
Sequence
MSLKIESEVKLESEPCVLAWDNKLFSYDANLTPGTSWSAHAVQIFAIAAGGGKVYSSSND
GGVRVWTAEGQKITELPHNEVDIAALTISGTHVVSGDEDGNARYNVLEEVKSVQYSPPFM
FTVRDLYVTVTEIQPEESKTRFVTRHSMEGRAPIKLLGNWLLVTAKGGNSLRLHHATVDK
EFKLMHEVRIESDQLEAAGDIDVGGCINALVASSNCVYAAVTGGRLTKIKAV
Download sequence
Identical sequences A0A0L7LTN7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]