SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L7LYN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7LYN9
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0000654
Family Capz beta-1 subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L7LYN9
Sequence length 84
Comment (tr|A0A0L7LYN9|A0A0L7LYN9_PLAF4) Uncharacterized protein {ECO:0000313|EMBL:KOB85707.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_01195 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGYLIECMENSLRKSIEYIYILKIQDMLNSIKYYNFTNHLTYNNTNKNISNISNSLIFSR
ENIQKELQTKIKQNGNMTKATRMI
Download sequence
Identical sequences A0A0L7LYN9
PFDG_01195T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]