SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L7M028 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L7M028
Domain Number - Region: 4-66
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0471
Family Capz beta-1 subunit 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7M028
Sequence length 69
Comment (tr|A0A0L7M028|A0A0L7M028_PLAF4) Uncharacterized protein {ECO:0000313|EMBL:KOB86234.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_01509 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNIPNTLNDIDEEKLKVEEKNKLYEKLLNNDESNYISKSMQTLSVFKKNKDIYVSTINKQ
NRSCYIKGL
Download sequence
Identical sequences A0A0L7M028
PFDG_01509T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]