SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L7M2K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L7M2K9
Domain Number - Region: 898-1010
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00149
Family UbiE/COQ5-like 0.057
Further Details:      
 
Domain Number - Region: 259-311
Classification Level Classification E-value
Superfamily MIR domain 0.0759
Family MIR domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7M2K9
Sequence length 1224
Comment (tr|A0A0L7M2K9|A0A0L7M2K9_PLAF4) Uncharacterized protein {ECO:0000313|EMBL:KOB86770.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_02646 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNPLSGFQINLNDLFTGDNTKKPENSWDYCIKRKRGCKCDTIKEELGSEHIAILNDLVDL
KKYYDEVCEKIVDKYQDVVHRFEYDKDIVKYIKKHNINDEIECVDWLYFYELLKERKILE
NIINTKEDKDNVTSLNSFHINEEANFISCINYYLKINKYNNVQHNWMGMSLNPFNEYINN
NYNFDIFNKNENIDDINKEKKNDFLNYHSLLKMKNEKEDIYNERKRDDILLYKDKKFYPL
YYYSYILYENEKWISGINNTGNILHLENIEYVWNKTVREGNKIKLFHLITCDCLKIKDIH
NIYMNNKEISKDKIKIIEESIHIERILCISQLVCSLGMINIGGCFIMKIKLSFDNFLLSI
FSILSICFKKVDVYRPSCCYLQNVIFLIGIHFNGITSIFLSCLNNWVQLAQKEIVPLLSC
NDKYNVEDNIGNVKENEQKKIKLNDNILHDNRKEHTMWDYINHSIIPLKWIKSNYLKEYK
NCINHFIEYIIYELKKCINVSNISLIKKNIENTKNTYISQFFEEHKIIDIKKKDKLIYKL
MDHIYEDVNLLNERYHEENKDKINDHKYNNIDNVSISSEDINNETFFNNNINNADNKNWL
KINNSILYETEEKGIYFRNTYYKNNYCNENIKKYRKKITALLKKIKFKNISNNHDNNINL
EDEDDINENKKKTNNYHNNNNNNNKNELFQLDEYIIKKRKFSMDKNLILKHHLEFENLLK
KQVYFTNKNWFKSYLHNNVDKYNNSFFFKKKNTFKDILKCRYYLYYNNYDIHINSFKQIL
KQYEPLNISYINYELHANVIDCLFTLTNCANLNIFQNSLFLQQFIVISNEQNVYNFFSKF
QSGHYVYFDAKIQSHILSEHGSKKRGADHSETFLNLDDMYENTKSYKAISELLISYIKDK
NSCSFIYIDMNSIYPNFVDVVEKELKIKNYLVGSLIIAYNFLKKNGNMIIRLSSVLTFFT
AGLIYILFCSFDKIEFFVPPSCDDISLDIFLYCHNFNENYIYRHYIQFIWDALICNKHID
EKLFNMDEKKKLDKPINKKRKADLYFSVPMYYLMNKHFVMFLKKFNSFYFKHHINVCLNF
MKEPKYFYHNKILIKSLLTHFFKAYVIQGKTFENVYKSIGMSFDNFYEGREDSDDEDEED
DEDEENKKEQEQEEEEEQKEEKEKTHEAYDEEKSFKAFLHLNRKESHAKNQFEFYSSDSN
YSIMCEYKNVPSEISISESAWDSS
Download sequence
Identical sequences A0A0L7M2K9
PFDG_02646T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]