SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L8FTC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8FTC9
Domain Number 1 Region: 206-345
Classification Level Classification E-value
Superfamily MIR domain 2.49e-24
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 415-554
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.1e-17
Family IP3 receptor type 1 binding core, domain 2 0.0034
Further Details:      
 
Domain Number 3 Region: 83-121
Classification Level Classification E-value
Superfamily MIR domain 0.0000196
Family MIR domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8FTC9
Sequence length 644
Comment (tr|A0A0L8FTC9|A0A0L8FTC9_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF67947.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22008543mg OC=Octopus.
Sequence
SSTNNVVYIYNKQDRTNPSNIQNPSAVVFQVCIQNRYKLNKKYRKALSASQAEYEPVVPD
IVKQAKMAAEAEDNDNASEQKRQHGKRVRYGEIVQLKHRFTSKYLHMCTTQTSQHDKNNM
MFNAKNAQFRILPRYKVKSEGEVVQLFDQIVFESVKSPGHFFHTSEKFQIDCNFEGSELN
LGVEKSSFTLVGCYREDLEDNRFVRGGSVIRLFHKELEAYLVAEGLFDEIITENVHFRIR
VMDQHHPKTMSPSTSGNTYWQIESESSILDGEVLNWEQQIRLRHLATRQYLCINSKSEVS
LTTDQTDPRTVFRLHSVLKERNQIQFESYARIEHMLTGYWLHALKGQMRFKFTTAVSAII
KLYRNIKFYTASVFTFCISVMPMTNRRVGSTVSSSNESQYDDAYTLQYVDDEAIKDFNFV
AGMVPFLYNLVNRHELHLNARITHGIIAGMKELKAFIIPDGRPDKNRQKLMRNLRVIDLL
VKILQLPLQGAEDESYMIRIFKEAYDVLHAYMIGRSRKNALYFAKYIDFFQTQFSQKGGI
GLNVAQMIVELIRDKRKIVDRIGHSNIELFINLLRENPNYRFLDLLQVLCVCNDVAIPNN
QSYIVQQWLRTYKRNHQALPTWHNELKMGREKKGEKVDLTITEL
Download sequence
Identical sequences A0A0L8FTC9
Ocbimv22008543m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]