SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8GEQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8GEQ3
Domain Number 1 Region: 6-43
Classification Level Classification E-value
Superfamily SAP domain 0.0000000117
Family SAP domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8GEQ3
Sequence length 63
Comment (tr|A0A0L8GEQ3|A0A0L8GEQ3_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF75497.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22034625mg OC=Octopus.
Sequence
MDIKQLDDSAIEVLTVPELKKYLRLYGQYVTGRKADLIERLKGIKILSICQQSKFIGRYF
RQE
Download sequence
Identical sequences A0A0L8GEQ3
Ocbimv22034625m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]