SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8GIJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8GIJ2
Domain Number 1 Region: 25-94
Classification Level Classification E-value
Superfamily Cullin repeat-like 6.8e-19
Family Cullin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8GIJ2
Sequence length 102
Comment (tr|A0A0L8GIJ2|A0A0L8GIJ2_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF76822.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22032883mg OC=Octopus.
Sequence
MSGGLRTHKRDTKMRIRAFPMTMDEKYVNSIWTLLRNAIQEIQKKNNSGLSFEELYRNAY
TMVLHKHGEKLYTGLREVVTEHLINKVGLITNSVLDTHFFSS
Download sequence
Identical sequences A0A0L8GIJ2
Ocbimv22032883m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]